PRMT1 (NM_001536) Human Recombinant Protein
CAT＃: TP324239
Recombinant protein of human protein arginine methyltransferase 1 (PRMT1), transcript variant 1, 20 µg
View other "PRMT1" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC224239 representing NM_001536
Red=Cloning site Green=Tags(s) MAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDE VRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVT IIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKD YKIHWWENVYGFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDY VHALVAYFNIEFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFT IDLDFKGQLCELSCSTDYRMR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 42.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | In vitro methylation assay (enzyme) (PMID: 26221041) |
| Reference Data | |
| RefSeq | NP_001527 |
| Locus ID | 3276 |
| UniProt ID | Q99873 |
| Refseq Size | 1386 |
| Cytogenetics | 19q13.33 |
| Refseq ORF | 1113 |
| Synonyms | ANM1; HCP1; HRMT1L2; IR1B4 |
| Summary | This gene encodes a member of the protein arginine N-methyltransferase (PRMT) family. Post-translational modification of target proteins by PRMTs plays an important regulatory role in many biological processes, whereby PRMTs methylate arginine residues by transferring methyl groups from S-adenosyl-L-methionine to terminal guanidino nitrogen atoms. The encoded protein is a type I PRMT and is responsible for the majority of cellular arginine methylation activity. Increased expression of this gene may play a role in many types of cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 5. [provided by RefSeq, Dec 2011] |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Dynamic arginine methylation of TNF receptor associated factor 6 regulates Toll-like receptor signaling
,Tikhanovich, I;Kuravi, S;Artigues, A;Villar, MT;Dorko, K;Nawabi, A;Roberts, B;Weinman, SA;,
J. Biol. Chem.
,PubMed ID 26221041
[PRMT1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405016 | PRMT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC405017 | PRMT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419868 | PRMT1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405016 | Transient overexpression lysate of protein arginine methyltransferase 1 (PRMT1), transcript variant 3 |
CNY 3080.00 |
|
| LY405017 | Transient overexpression lysate of protein arginine methyltransferase 1 (PRMT1), transcript variant 2 |
CNY 3080.00 |
|
| LY419868 | Transient overexpression lysate of protein arginine methyltransferase 1 (PRMT1), transcript variant 1 |
CNY 3080.00 |
|
| PH314074 | PRMT1 MS Standard C13 and N15-labeled recombinant protein (NP_938075) |
CNY 14250.00 |
|
| PH324239 | PRMT1 MS Standard C13 and N15-labeled recombinant protein (NP_001527) |
CNY 19520.00 |
|
| TP314074 | Recombinant protein of human protein arginine methyltransferase 1 (PRMT1), transcript variant 2, 20 µg |
CNY 2900.00 |
