RASSF3 (NM_178169) Human Recombinant Protein
CAT#: TP324614
Recombinant protein of human Ras association (RalGDS/AF-6) domain family member 3 (RASSF3), 20 µg
View other "RASSF3" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224614 protein sequence
Red=Cloning site Green=Tags(s) MSSGYSSLEEDAEDFFFTARTSFFRRAPQGKPRSGQQDVEKEKETHSYLSKEEIKEKVHKYNLAVTDKLK MTLNSNGIYTGFIKVQMELCKPPQTSPNSGKLSPSSNGCMNTLHISSTNTVGEVIEALLKKFLVTESPAK FALYKRCHREDQVYACKLSDREHPLYLRLVAGPRTDTLSFVLREHEIGEWEAFSLPELQNFLRILDKEED EQLQNLKRRYTAYRQKLEEALREVWKPD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_835463 |
Locus ID | 283349 |
UniProt ID | Q86WH2 |
Refseq Size | 3492 |
Cytogenetics | 12q14.2 |
Refseq ORF | 714 |
Synonyms | RASSF5 |
Summary | The RAS oncogene (MIM 190020) is mutated in nearly one-third of all human cancers. Members of the RAS superfamily are plasma membrane GTP-binding proteins that modulate intracellular signal transduction pathways. A subfamily of RAS effectors, including RASSF3, share a RAS association (RA) domain.[supplied by OMIM, Jul 2003] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406009 | RASSF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406009 | Transient overexpression lysate of Ras association (RalGDS/AF-6) domain family member 3 (RASSF3) |
CNY 3080.00 |
|
PH324614 | RASSF3 MS Standard C13 and N15-labeled recombinant protein (NP_835463) |
CNY 19520.00 |