hnRNP R (HNRNPR) (NM_001102397) Human Recombinant Protein
CAT#: TP324683
Recombinant protein of human heterogeneous nuclear ribonucleoprotein R (HNRNPR), transcript variant 4, 20 µg
View other "hnRNP R" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC224683 representing NM_001102397
Red=Cloning site Green=Tags(s) MKTYRQREKQGSKVQESTKGPDEAKIKALLERTGYTLDVTTGQRKYGGPPPDSVYSGVQPGIGTEVFVGK IPRDLYEDELVPLFEKAGPIWDLRLMMDPLSGQNRGYAFITFCGKEAAQEAVKLCDSYEIRPGKHLGVCI SVANNRLFVGSIPKNKTKENILEEFSKVTEGLVDVILYHQPDDKKKNRGFCFLEYEDHKSAAQARRRLMS GKVKVWGNVVTVEWADPVEEPDPEVMAKVKVLFVRNLATTVTEEILEKSFSEFGKLERVKKLKDYAFVHF EDRGAAVKAMDEMNGKEIEGEEIEIVLAKPPDKKRKERQAARQASRSTAYEDYYYHPPPRMPPPIRGRGR GGGRGGYGYPPDYYGYEDYYDDYYGYDYHDYRGGYEDPYYGYDDGYAVRGRGGGRGGRGAPPPPRGRGAP PPRGRAGYSQRGAPLGPPRGSRGGRGGPAQQQRGRGSRGSRGNRGGNVGGKRKADGYNQPDSKRRQTNNQ QNWGSQPIAQQPLQQGGDYSGNYGYNNDNQEFYQDTYGQQWK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 59.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001095867 |
| Locus ID | 10236 |
| UniProt ID | Q0VGD6 |
| Refseq Size | 2585 |
| Cytogenetics | 1p36.12 |
| Refseq ORF | 1596 |
| Synonyms | hnRNP-R; HNRPR |
| Summary | This gene encodes an RNA-binding protein that is a member of the spliceosome C complex, which functions in pre-mRNA processing and transport. The encoded protein also promotes transcription at the c-fos gene. Alternative splicing results in multiple transcript variants. There are pseudogenes for this gene on chromosomes 4, 11, and 10. [provided by RefSeq, Jul 2014] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417046 | HNRNPR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC420140 | HNRNPR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY417046 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein R (HNRNPR), transcript variant 2 |
CNY 4840.00 |
|
| LY420140 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein R (HNRNPR), transcript variant 4 |
CNY 4840.00 |
|
| PH324502 | HNRNPR MS Standard C13 and N15-labeled recombinant protein (NP_005817) |
CNY 19520.00 |
|
| PH324683 | HNRNPR MS Standard C13 and N15-labeled recombinant protein (NP_001095867) |
CNY 19520.00 |
|
| TP324502 | Recombinant protein of human heterogeneous nuclear ribonucleoprotein R (HNRNPR), transcript variant 2, 20 µg |
CNY 2900.00 |
其它hnRNP R产品
