TAL2 (NM_005421) Human Recombinant Protein
CAT#: TP324692
Recombinant protein of human T-cell acute lymphocytic leukemia 2 (TAL2), 20 µg
View other "TAL2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224692 protein sequence
Red=Cloning site Green=Tags(s) MTRKIFTNTRERWRQQNVNSAFAKLRKLIPTHPPDKKLSKNETLRLAMRYINFLVKVLGEQSLQQTGVAA QGNILGLFPQGPHLPGLEDRTLLENYQVPSPGPSHHIP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005412 |
Locus ID | 6887 |
UniProt ID | Q16559 |
Refseq Size | 656 |
Cytogenetics | 9q31.2 |
Refseq ORF | 324 |
Summary | This intronless gene encodes a helix-loop-helix protein. Translocations between this gene on chromosome 9 and the T-cell receptor beta-chain locus on chromosome 7 have been associated with activation of the T-cell acute lymphocytic leukemia 2 gene and T-cell acute lymphoblastic leukemia. [provided by RefSeq, Mar 2009] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417315 | TAL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417315 | Transient overexpression lysate of T-cell acute lymphocytic leukemia 2 (TAL2) |
CNY 3080.00 |
|
PH324692 | TAL2 MS Standard C13 and N15-labeled recombinant protein (NP_005412) |
CNY 19520.00 |