IL36 gamma (IL36G) (NM_019618) Human Recombinant Protein
CAT#: TP324784
Recombinant protein of human interleukin 1 family, member 9 (IL1F9), 20 µg
View other "IL36 gamma" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC224784 protein sequence
Red=Cloning site Green=Tags(s) MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQG RGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFI ASSKRDQPIILTSELGKSYNTAFELNIND myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 18.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_062564 |
| Locus ID | 56300 |
| UniProt ID | Q9NZH8 |
| Refseq Size | 1212 |
| Cytogenetics | 2q14.1 |
| Refseq ORF | 507 |
| Synonyms | IL-1F9; IL-1H1; IL-1RP2; IL1E; IL1F9; IL1H1; IL1RP2 |
| Summary | The protein encoded by this gene is a member of the interleukin 1 cytokine family. The activity of this cytokine is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). Interferon-gamma, tumor necrosis factor-alpha and interleukin 1, beta (IL1B) are reported to stimulate the expression of this cytokine in keratinocytes. The expression of this cytokine in keratinocytes can also be induced by a contact hypersensitivity reaction or herpes simplex virus infection. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. [provided by RefSeq, May 2019] |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412705 | IL36G HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412705 | Transient overexpression lysate of interleukin 1 family, member 9 (IL1F9) |
CNY 3080.00 |
|
| PH324784 | IL1F9 MS Standard C13 and N15-labeled recombinant protein (NP_062564) |
CNY 19520.00 |
其它IL36 gamma产品
