CTBP2 (NM_001329) Human Recombinant Protein
CAT#: TP324861
Recombinant protein of human C-terminal binding protein 2 (CTBP2), transcript variant 1, 20 µg
View other "CTBP2" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 2 publications. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC224861 representing NM_001329
Red=Cloning site Green=Tags(s) MALVDKHKVKRQRLDRICEGIRPQIMNGPLHPRPLVALLDGRDCTVEMPILKDLATVAFCDAQSTQEIHE KVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTIC HILNLYRRNTWLYQALREGTRVQSVEQIREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYD PYLQDGIERSLGVQRVYTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKA LAQALKEGRIRGAALDVHESEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIP ESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPAAMEGIIPGGIPVTHNLPTV AHPSQAPSPNQPTKHGDNREHPNEQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 48.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001320 |
| Locus ID | 1488 |
| UniProt ID | P56545 |
| Refseq Size | 2368 |
| Cytogenetics | 10q26.13 |
| Refseq ORF | 1335 |
| Summary | This gene produces alternative transcripts encoding two distinct proteins. One protein is a transcriptional repressor, while the other isoform is a major component of specialized synapses known as synaptic ribbons. Both proteins contain a NAD+ binding domain similar to NAD+-dependent 2-hydroxyacid dehydrogenases. A portion of the 3' untranslated region was used to map this gene to chromosome 21q21.3; however, it was noted that similar loci elsewhere in the genome are likely. Blast analysis shows that this gene is present on chromosome 10. Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Feb 2014] |
| Protein Families | Stem cell - Pluripotency, Stem cell relevant signaling - Wnt Signaling pathway |
| Protein Pathways | Chronic myeloid leukemia, Notch signaling pathway, Pathways in cancer, Wnt signaling pathway |
Citations (2)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Phenformin Inhibits Hedgehog-Dependent Tumor Growth through a Complex I-Independent Redox/Corepressor Module
,Di Magno, L;Manni, S;Di Pastena, F;Coni, S;Macone, A;Cairoli, S;Sambucci, M;Infante, P;Moretti, M;Petroni, M;Nicoletti, C;Capalbo, C;De Smaele, E;Di Marcotullio, L;Giannini, G;Battistini, L;Goffredo, BM;Iorio, E;Agostinelli, E;Maroder, M;Canettieri, G;,
Cell Rep
,PubMed ID 32049007
[CTBP2]
|
|
ZNF750 interacts with KLF4 and RCOR1, KDM1A, and CTBP1/2 chromatin regulators to repress epidermal progenitor genes and induce differentiation genes
,Boxer, LD;Barajas, B;Tao, S;Zhang, J;Khavari, PA;,
Genes Dev.
,PubMed ID 25228645
[CTBP2]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC420003 | CTBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC421253 | CTBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY420003 | Transient overexpression lysate of C-terminal binding protein 2 (CTBP2), transcript variant 1 |
CNY 4840.00 |
|
| LY421253 | Transient overexpression lysate of C-terminal binding protein 2 (CTBP2), transcript variant 3 |
CNY 4840.00 |
|
| PH313339 | CTBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001077383) |
CNY 19520.00 |
|
| PH324861 | CTBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001320) |
CNY 19520.00 |
|
| TP313339 | Recombinant protein of human C-terminal binding protein 2 (CTBP2), transcript variant 3, 20 µg |
CNY 2900.00 |


