IGFL2 (NM_001135113) Human Recombinant Protein
CAT#: TP325054
Purified recombinant protein of Human IGF-like family member 2 (IGFL2), transcript variant 2,full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20 µg
View other "IGFL2" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225054 representing NM_001135113
Red=Cloning site Green=Tags(s) MVPRIFAPAYVSVCLLLLCPREVIAPAGSEPWLCQPAPRCGDKIYNPLEQCCYNDAIVSLSETRQCGPPC TFWPCFELCCLDSFGLTNDFVVKLKVQGVNSQCHSSPISSKCESRRRFP myc-FLAG tag |
Tag | Myc-DDK |
Predicted MW | 13.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate Bradford method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product when appropriate storage and handling conditions are followed. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001128585 |
Locus ID | 147920 |
UniProt ID | Q6UWQ7 |
Cytogenetics | 19q13.32 |
Refseq ORF | 357 |
Synonyms | UNQ645; VPRI645 |
Summary | IGFL2 belongs to the insulin-like growth factor (IGF; see MIM 147440) family of signaling molecules that play critical roles in cellular energy metabolism and in growth and development, especially prenatal growth (Emtage et al., 2006 [PubMed 16890402]).[supplied by OMIM, Mar 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424111 | IGFL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427558 | IGFL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424111 | Transient overexpression lysate of IGF-like family member 2 (IGFL2), transcript variant 1 |
CNY 3080.00 |
|
LY427558 | Transient overexpression lysate of IGF-like family member 2 (IGFL2), transcript variant 2 |
CNY 3080.00 |
|
TP701233 | Purified recombinant protein of Human IGF-like family member 2 (IGFL2), transcript variant 2, Pro26-End, with C-terminal Myc/DDK tag, expressed in HEK293 cells, 50ug |
CNY 7820.00 |