PARK7 (NM_001123377) Human Recombinant Protein
CAT#: TP325206
Recombinant protein of human Parkinson disease (autosomal recessive, early onset) 7 (PARK7), transcript variant 2, 20 µg
View other "PARK7" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC225206 protein sequence
Red=Cloning site Green=Tags(s) MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVV VLPGGNLGAQNLSESAAVKEILKEQENRKGLIAAICAGPTALLAHEIGFGSKVTTHPLAKDKMMNGGHYT YSENRVEKDGLILTSRGPGTSFEFALAIVEALNGKEVAAQVKAPLVLKD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 19.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001116849 |
| Locus ID | 11315 |
| UniProt ID | Q99497 |
| Refseq Size | 921 |
| Cytogenetics | 1p36.23 |
| Refseq ORF | 567 |
| Synonyms | DJ-1; DJ1; GATD2; HEL-S-67p |
| Summary | The product of this gene belongs to the peptidase C56 family of proteins. It acts as a positive regulator of androgen receptor-dependent transcription. It may also function as a redox-sensitive chaperone, as a sensor for oxidative stress, and it apparently protects neurons against oxidative stress and cell death. Defects in this gene are the cause of autosomal recessive early-onset Parkinson disease 7. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Protease |
| Protein Pathways | Parkinson's disease |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402122 | PARK7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426614 | PARK7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402122 | Transient overexpression lysate of Parkinson disease (autosomal recessive, early onset) 7 (PARK7), transcript variant 1 |
CNY 3080.00 |
|
| LY426614 | Transient overexpression lysate of Parkinson disease (autosomal recessive, early onset) 7 (PARK7), transcript variant 2 |
CNY 3080.00 |
|
| PH325206 | PARK7 MS Standard C13 and N15-labeled recombinant protein (NP_001116849) |
CNY 19520.00 |
|
| TP301645 | Recombinant protein of human Parkinson disease (autosomal recessive, early onset) 7 (PARK7), transcript variant 1, 20 µg |
CNY 2900.00 |
