CLDN19 (NM_001123395) Human Recombinant Protein
CAT#: TP325251
Recombinant protein of human claudin 19 (CLDN19), transcript variant 2, 20 µg
View other "CLDN19" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225251 representing NM_001123395
Red=Cloning site Green=Tags(s) MANSGLQLLGYFLALGGWVGIIASTALPQWKQSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSL LALDGHIQSARALMVVAVLLGFVAMVLSVVGMKCTRVGDSNPIAKGRVAIAGGALFILAGLCTLTAVSWY ATLVTQEFFNPSTPVNARYEFGPALFVGWASAGLAVLGGSFLCCTCPEPERPNSSPQPYRPGPSAAAREY V myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001116867 |
Locus ID | 149461 |
UniProt ID | Q8N6F1 |
Cytogenetics | 1p34.2 |
Refseq ORF | 633 |
Synonyms | HOMG5 |
Summary | The product of this gene belongs to the claudin family. It plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. Defects in this gene are the cause of hypomagnesemia renal with ocular involvement (HOMGO). HOMGO is a progressive renal disease characterized by primary renal magnesium wasting with hypomagnesemia, hypercalciuria and nephrocalcinosis associated with severe ocular abnormalities such as bilateral chorioretinal scars, macular colobomata, significant myopia and nystagmus. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jun 2010] |
Protein Families | Transmembrane |
Protein Pathways | Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407723 | CLDN19 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426624 | CLDN19 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407723 | Transient overexpression lysate of claudin 19 (CLDN19), transcript variant 1 |
CNY 3080.00 |
|
LY426624 | Transient overexpression lysate of claudin 19 (CLDN19), transcript variant 2 |
CNY 3080.00 |
|
PH316887 | CLDN19 MS Standard C13 and N15-labeled recombinant protein (NP_683763) |
CNY 19520.00 |
|
PH325251 | CLDN19 MS Standard C13 and N15-labeled recombinant protein (NP_001116867) |
CNY 14250.00 |
|
TP316887 | Recombinant protein of human claudin 19 (CLDN19), transcript variant 1, 20 µg |
CNY 2900.00 |