SYCE2 (NM_001105578) Human Recombinant Protein
CAT#: TP325261
Recombinant protein of human synaptonemal complex central element protein 2 (SYCE2), 20 µg
View other "SYCE2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC225261 representing NM_001105578
Red=Cloning site Green=Tags(s) MERQGVDVPHVKCKDQEPQPLGESKEHPRWEENCEEEAGGGPASASCQLTVLEGKSGLYFSSLDSSIDIL QKRAQELIENINKSRQKDHALMTNFRNSLKTKVSDLTEKLEERIYQIYNDHNKIIQEKLQEFTQKMAKIS HLETELKQVCHSVETVYKDLCLQPEQSLRLRWGPDHSRGKSPPRPGNSQPPDVFVSSVAETTSQATASEV QTNRDGEC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 24.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001099048 |
| Locus ID | 256126 |
| UniProt ID | Q6PIF2 |
| Cytogenetics | 19p13.13 |
| Refseq ORF | 654 |
| Synonyms | CESC1 |
| Summary | The protein encoded by this gene is part of the synaptonemal complex formed between homologous chromosomes during meiotic prophase. The encoded protein associates with SYCP1 and SYCE1 and is found only where chromosome cores are synapsed. [provided by RefSeq, Dec 2012] |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Somatic role of SYCE2: an insulator that dissociates HP1α from H3K9me3 and potentiates DNA repair
,Hosoya, N;Ono, M;Miyagawa, K;,
Life Sci. Alliance
[SYCE2]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC426288 | SYCE2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY426288 | Transient overexpression lysate of synaptonemal complex central element protein 2 (SYCE2) |
CNY 3080.00 |
|
| PH325261 | SYCE2 MS Standard C13 and N15-labeled recombinant protein (NP_001099048) |
CNY 19520.00 |

