ASPDH (NM_001114598) Human Recombinant Protein
CAT＃: TP325390
Recombinant protein of human aspartate dehydrogenase domain containing (ASPDH), transcript variant 1, 20 µg
View other "ASPDH" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC225390 representing NM_001114598
Red=Cloning site Green=Tags(s) MADRGPWRVGVVGYGRLGQSLVSRLLAQGPELGLELVFVWNRDPGRMAGSVPPSLQLQNLAALGERRPDL VVEVAHPKIIHESGAQILRHANLLVGSPSALSDQTTERQLLEASQHWDHAVFVARGALWGAEDIRRLDAA GGLRSLRVTMATHPDGFRLEGPLAAAHSPGPCTVLYEGPVRGLCPFAPRNSNTMAAAALAAPSLGFDGVI GVLVADTSLTDMHVVDVELSGPRGPTGRSFAVHTRRENPAEPGAVTGSATVTAFWQSLLACCQLPSRPGI HLC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 29.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001108070 |
| Locus ID | 554235 |
| UniProt ID | A6ND91 |
| Cytogenetics | 19q13.33 |
| Refseq ORF | 849 |
| Summary | Specifically catalyzes the NAD or NADP-dependent dehydrogenation of L-aspartate to iminoaspartate.[UniProtKB/Swiss-Prot Function] |
| Shipping | Dry Ice |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC422526 | ASPDH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426491 | ASPDH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY422526 | Transient overexpression lysate of aspartate dehydrogenase domain containing (ASPDH), transcript variant 2 |
CNY 3080.00 |
|
| LY426491 | Transient overexpression lysate of aspartate dehydrogenase domain containing (ASPDH), transcript variant 1 |
CNY 3080.00 |
|
| PH325390 | ASPDH MS Standard C13 and N15-labeled recombinant protein (NP_001108070) |
CNY 14250.00 |
|
| TP760231 | Recombinant protein of human aspartate dehydrogenase domain containing (ASPDH), transcript variant 2, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
|
| TP760327 | Purified recombinant protein of Homo sapiens aspartate dehydrogenase domain containing (ASPDH), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
