Heme oxygenase 2 (HMOX2) (NM_001127205) Human Recombinant Protein
CAT#: TP325452
Purified recombinant protein of Homo sapiens heme oxygenase (decycling) 2 (HMOX2), transcript variant 2, 20 µg
View other "Heme oxygenase 2" proteins (13)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC225452 representing NM_001127205
Red=Cloning site Green=Tags(s) MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKGNIKKELFKLA TTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGENWEEQVQCPKAAQKYVERIHY IGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPSTGEGTQFYLFENVDNAQQFKQLYRARMNALD LNMKTKERIVEEANKAFEYNMQIFNELDQAGSTLARETLEDGFPVHDGKGDMRKCPFYAAEQDKGALEGS SCPFRTAMAVLRKPSLQFILAAGVALAAGLLAWYYM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 35.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001120677 |
| Locus ID | 3163 |
| UniProt ID | P30519 |
| Refseq Size | 1776 |
| Cytogenetics | 16p13.3 |
| Refseq ORF | 948 |
| Synonyms | HO-2 |
| Summary | Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. Several alternatively spliced transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq, Oct 2013] |
| Protein Families | Transmembrane |
| Protein Pathways | Porphyrin and chlorophyll metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419512 | HMOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426707 | HMOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426708 | HMOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426709 | HMOX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419512 | Transient overexpression lysate of heme oxygenase (decycling) 2 (HMOX2), transcript variant 3 |
CNY 3080.00 |
|
| LY426707 | Transient overexpression lysate of heme oxygenase (decycling) 2 (HMOX2), transcript variant 1 |
CNY 3080.00 |
|
| LY426708 | Transient overexpression lysate of heme oxygenase (decycling) 2 (HMOX2), transcript variant 2 |
CNY 3080.00 |
|
| LY426709 | Transient overexpression lysate of heme oxygenase (decycling) 2 (HMOX2), transcript variant 4 |
CNY 3080.00 |
|
| PH301777 | HMOX2 MS Standard C13 and N15-labeled recombinant protein (NP_002125) |
CNY 19520.00 |
|
| PH325452 | HMOX2 MS Standard C13 and N15-labeled recombinant protein (NP_001120677) |
CNY 14250.00 |
|
| PH325453 | HMOX2 MS Standard C13 and N15-labeled recombinant protein (NP_001120678) |
CNY 14250.00 |
|
| TP301777 | Recombinant protein of human heme oxygenase (decycling) 2 (HMOX2), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP325453 | Purified recombinant protein of Homo sapiens heme oxygenase (decycling) 2 (HMOX2), transcript variant 4, 20 µg |
CNY 2900.00 |
其它Heme oxygenase 2产品
