p53 (TP53) (NM_001126114) Human Recombinant Protein
CAT#: TP325502
Purified recombinant protein of Homo sapiens tumor protein p53 (TP53), transcript variant 3, 20 µg
View other "p53" proteins (16)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 9 publications. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225502 representing NM_001126114
Red=Cloning site Green=Tags(s) MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAA PPVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKT CPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRN TFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGR DRRTEEENLRKKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQDQTSFQKENC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001119586 |
Locus ID | 7157 |
UniProt ID | P04637 |
Cytogenetics | 17p13.1 |
Refseq ORF | 1023 |
Synonyms | BCC7; BMFS5; LFS1; P53; TRP53 |
Summary | This gene encodes a tumor suppressor protein containing transcriptional activation, DNA binding, and oligomerization domains. The encoded protein responds to diverse cellular stresses to regulate expression of target genes, thereby inducing cell cycle arrest, apoptosis, senescence, DNA repair, or changes in metabolism. Mutations in this gene are associated with a variety of human cancers, including hereditary cancers such as Li-Fraumeni syndrome. Alternative splicing of this gene and the use of alternate promoters result in multiple transcript variants and isoforms. Additional isoforms have also been shown to result from the use of alternate translation initiation codons from identical transcript variants (PMIDs: 12032546, 20937277). [provided by RefSeq, Dec 2016] |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
Protein Pathways | Amyotrophic lateral sclerosis (ALS), Apoptosis, Basal cell carcinoma, Bladder cancer, Cell cycle, Chronic myeloid leukemia, Colorectal cancer, Endometrial cancer, Glioma, Huntington's disease, MAPK signaling pathway, Melanoma, Neurotrophin signaling pathway, Non-small cell lung cancer, p53 signaling pathway, Pancreatic cancer, Pathways in cancer, Prostate cancer, Small cell lung cancer, Thyroid cancer, Wnt signaling pathway |
Citations (9)
The use of this Proteins has been cited in the following citations: |
---|
Zinc shapes the folding landscape of p53 and establishes a pathway for reactivating structurally diverse cancer mutants
,null,
eLife
,PubMed ID 33263541
[TP53]
|
Brother of regulator of imprinted sites inhibits cisplatin-induced DNA damage in non-small cell lung cancer
,null,
Oncology Letters
,PubMed ID 32994814
[TP53]
|
Arecoline N-oxide regulates oral squamous cell carcinoma development through NOTCH1 and FAT1 expressions.
,null,
Journal of cellular physiology
,PubMed ID 30624777
[TP53]
|
The miR-644a/CTBP1/p53 axis suppresses drug resistance by simultaneous inhibition of cell survival and epithelial-mesenchymal transition in breast cancer
,null,
Oncotarget
,PubMed ID 27409664
[TP53]
|
Species-specific mutual regulation of p53 and miR-138 between human, rat and mouse
,null,
Scientific Reports
,PubMed ID 27183959
[TP53]
|
Combined CSL and p53 downregulation promotes cancer-associated fibroblast activation
,null,
Nature cell biology
,PubMed ID 26302407
[TP53]
|
FATS is an E2-independent ubiquitin ligase that stabilizes p53 and promotes its activation in response to DNA damage.
,null,
Oncogene
,PubMed ID 24240685
[TP53]
|
Regulation of carboxylesterase-2 expression by p53 family proteins and enhanced anti-cancer activities among 5-fluorouracil, irinotecan and doxazolidine prodrug
,null,
British Journal of Pharmacology
,PubMed ID 23373735
[TP53]
|
p53 opens the mitochondrial permeability transition pore to trigger necrosis
,null,
Cell
,PubMed ID 22726440
[TP53]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400186 | TP53 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426652 | TP53 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426653 | TP53 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426654 | TP53 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400186 | Transient overexpression lysate of tumor protein p53 (TP53), transcript variant 1 |
CNY 3080.00 |
|
LY426652 | Transient overexpression lysate of tumor protein p53 (TP53), transcript variant 2 |
CNY 3080.00 |
|
LY426653 | Transient overexpression lysate of tumor protein p53 (TP53), transcript variant 4 |
CNY 3080.00 |
|
LY426654 | Transient overexpression lysate of tumor protein p53 (TP53), transcript variant 3 |
CNY 3080.00 |
|
PH300003 | TP53 MS Standard C13 and N15-labeled recombinant protein (NP_000537) |
CNY 19520.00 |
|
PH325502 | TP53 MS Standard C13 and N15-labeled recombinant protein (NP_001119586) |
CNY 14250.00 |
|
PH325604 | TP53 MS Standard C13 and N15-labeled recombinant protein (NP_001119584) |
CNY 19520.00 |
|
TP300003 | Recombinant protein of human tumor protein p53 (TP53), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP325604 | Recombinant protein of human tumor protein p53 (TP53), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP701001 | Purified recombinant protein of human tumor protein P53 (TP53), transcript variant 1, mutant (Y220C), expressed in HEK293 cells, 20ug |
CNY 6650.00 |
|
TP710022 | Recombinant protein of human tumor protein p53 (TP53), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9 cells. |
CNY 4020.00 |
|
TP750119 | Purified recombinant protein of Human tumor protein p53 (TP53), transcript variant 1, full length, N-terminal His and GST tag, expressed in E. coli, 50ug |
CNY 2000.00 |