CCBL1 (KYAT1) (NM_001122671) Human Recombinant Protein
CAT＃: TP325677
Recombinant protein of human cysteine conjugate-beta lyase, cytoplasmic (CCBL1), transcript variant 2, 20 µg
View other "CCBL1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC225677 representing NM_001122671
Red=Cloning site Green=Tags(s) MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFGYP PLTKILASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPV FVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVC ITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHC PTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRK MPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKV EL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 47.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001116143 |
| Locus ID | 883 |
| UniProt ID | Q16773 |
| Cytogenetics | 9q34.11 |
| Refseq ORF | 1266 |
| Synonyms | CCBL1; GTK; KAT1; KATI |
| Summary | This gene encodes a cytosolic enzyme that is responsible for the metabolism of cysteine conjugates of certain halogenated alkenes and alkanes. This metabolism can form reactive metabolites leading to nephrotoxicity and neurotoxicity. Increased levels of this enzyme have been linked to schizophrenia. Multiple transcript variants that encode different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401315 | CCBL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC426545 | CCBL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401315 | Transient overexpression lysate of cysteine conjugate-beta lyase, cytoplasmic (CCBL1), transcript variant 1 |
CNY 4840.00 |
|
| LY426545 | Transient overexpression lysate of cysteine conjugate-beta lyase, cytoplasmic (CCBL1), transcript variant 2 |
CNY 3080.00 |
|
| PH316317 | CCBL1 MS Standard C13 and N15-labeled recombinant protein (NP_004050) |
CNY 19520.00 |
|
| PH325677 | CCBL1 MS Standard C13 and N15-labeled recombinant protein (NP_001116143) |
CNY 19520.00 |
|
| TP316317 | Recombinant protein of human cysteine conjugate-beta lyase, cytoplasmic (CCBL1), transcript variant 1, 20 µg |
CNY 2900.00 |
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
