RIPX (RUFY3) (NM_001130709) Human Recombinant Protein
CAT#: TP325870
Recombinant protein of human RUN and FYVE domain containing 3 (RUFY3), transcript variant 3, 20 µg
View other "RIPX" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC225870 representing NM_001130709
Red=Cloning site Green=Tags(s) MAETPPPPTAGAESCSEEPARGGEWRPEEPRRAPAGGTDREGEAGPPPASPAGQSEPDSPVAAPFFLLYP GDGGAGFGVRPPPQQQRSWRTPPSPGSPLPFLLLSYPSGGGGSSGSGKHHPNYLMANERMNLMNMAKLSI KGLIESALNLGRTLDSDYAPLQQFFVVMEHCLKHGLKAKKTFLGQNKSFWGPLELVEKLVPEAAEITASV KDLPGLKTPVGRGRAWLRLALMQKKLSEYMKALINKKELLSEFYEPNALMMEEEGAIIAGLLVGLNVIDA NFCMKGEDLDSQVGVIDFSMYLKDGNSSKGTEGDGQITAILDQKNYVEELNRHLNATVNNLQAKVDALEK SNTKLTEELAVANNRIITLQEEMERVKEESSYILESNRKGPKQDRTAEGQALSEARKHLKEETQLRLDVE KELEMQISMRQEMELAMKMLEKDVCEKQDALVSLRQQLDDLRALKHELAFKLQSSDLGVKQKSELNSRLE EKTNQMAATIKQLEQR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 55.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001124181 |
| Locus ID | 22902 |
| UniProt ID | Q7L099 |
| Cytogenetics | 4q13.3 |
| Refseq ORF | 1518 |
| Synonyms | RIPX; SINGAR1; ZFYVE30 |
| Summary | This gene encodes a RPIP8, UNC-14, and NESCA domain-containing protein that is required for maintenance of neuronal polarity. In addition, it has been implicated in mediation of gastric cancer cell migration and invasion via interaction with P21-activated kinase-1, which promotes its expression. The encoded protein localizes to F-actin-enriched invadopodia to induce formation of protrusions, thereby facilitating cell migration. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2016] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414890 | RUFY3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427257 | RUFY3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414890 | Transient overexpression lysate of RUN and FYVE domain containing 3 (RUFY3), transcript variant 2 |
CNY 3080.00 |
|
| LY427257 | Transient overexpression lysate of RUN and FYVE domain containing 3 (RUFY3), transcript variant 3 |
CNY 3080.00 |
|
| PH307961 | RUFY3 MS Standard C13 and N15-labeled recombinant protein (NP_055776) |
CNY 19520.00 |
|
| PH325870 | RUFY3 MS Standard C13 and N15-labeled recombinant protein (NP_001124181) |
CNY 14250.00 |
|
| TP307961 | Recombinant protein of human RUN and FYVE domain containing 3 (RUFY3), transcript variant 2, 20 µg |
CNY 2900.00 |
