TBXAS1 (NM_001130966) Human Recombinant Protein
CAT#: TP325917
Recombinant protein of human thromboxane A synthase 1 (platelet) (TBXAS1), transcript variant TXS-III, 20 µg
View other "TBXAS1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC225917 protein sequence
Red=Cloning site Green=Tags(s) MMEALGFLKLEVNGPMVTVALSVALLALLKWYSTSAFSRLEKLGLRHPKPSPFIGNLTFFRQGFWESQME LRKLYGPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEFKSVADSVLFLRDKRWEEVRGAL MSAFSPEKLNEMVPLISQACDLLLAHLKRYAESGDAFDIQRCYCNYTTDVVASVAFGTPVDSWQAPEDPF VKHCKRFFEFCIPRPILVLLLSFPSIMVPLARILPNKNRDELNGFFNKLIRNVIALRDQQAAEERRRDFL QMVLDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIVGQAFIFLIAGYEIITNT LSFATYLLATNPDCQEKLLREVDVFKEKHMAPEFCSLEEGLPYLDMVIAETLRMYPPAFRFTREAAQDCE VLGQRIPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEARQQHRPFTYLPFGAGPRSCLGVRLGLLEV KLTLLHVLHKFRFQACPETQVPLQLESKSALGPKNGVYIKIVSR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 60.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001124438 |
| Locus ID | 6916 |
| UniProt ID | P24557 |
| Refseq Size | 2385 |
| Cytogenetics | 7q34 |
| Refseq ORF | 1602 |
| Synonyms | BDPLT14; CYP5; CYP5A1; GHOSAL; THAS; TS; TXAS; TXS |
| Summary | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity. This endoplasmic reticulum membrane protein catalyzes the conversion of prostglandin H2 to thromboxane A2, a potent vasoconstrictor and inducer of platelet aggregation. The enzyme plays a role in several pathophysiological processes including hemostasis, cardiovascular disease, and stroke. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2008] |
| Protein Families | Druggable Genome, P450 |
| Protein Pathways | Arachidonic acid metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC420741 | TBXAS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427328 | TBXAS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY420741 | Transient overexpression lysate of thromboxane A synthase 1 (platelet) (TBXAS1), transcript variant 1 |
CNY 3080.00 |
|
| LY427328 | Transient overexpression lysate of thromboxane A synthase 1 (platelet) (TBXAS1), transcript variant 3 |
CNY 3080.00 |
|
| PH308028 | TBXAS1 MS Standard C13 and N15-labeled recombinant protein (NP_001052) |
CNY 19520.00 |
|
| PH325917 | TBXAS1 MS Standard C13 and N15-labeled recombinant protein (NP_001124438) |
CNY 19520.00 |
|
| TP308028 | Recombinant protein of human thromboxane A synthase 1 (platelet) (TBXAS1), transcript variant TXS-I, 20 µg |
CNY 2900.00 |


