DNAJC2 (NM_001129887) Human Recombinant Protein
CAT#: TP325965
Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 2 (DNAJC2), transcript variant 2, 20 µg
View other "DNAJC2" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225965 representing NM_001129887
Red=Cloning site Green=Tags(s) MLLLPSAADGRGTAITHALTSASTLCQVEPVGRWFEAFVKRRNRNASASFQELEDKKELSEESEDEELQL EEFPMLKTLDPKDWKNQDHYAVLGLGHVRYKATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEGDNDYFTC ITKAYEMLSDPVKRRAFNSVDPTFDNSVPSKSEAKDNFFEVFTPVFERNSRWSNKKNVPKLGDMNSSFED VDIFYSFWYNFDSWREFSYLDEEEKEKAECRDERRWIEKQNRATRAQRKKEEMNRIRTLVDNAYSCDPRI KKFKEEEKAKKEAEKKAKAEAKRKEQEAKEKQRQAELEAARLAKEKEEEEVRQQALLAKKEKDIQKKAIK KERQKLRNSCKIEEINEQIRKEKEEAEARMRQASKNTEKSTGGGGNGSKNWSEDDLQLLIKAVNLFPAGT NSRWEVIANYMNIHSSSGVKRTAKDVIGKAKSLQKLDPHQKDDINKKAFDKFKKEHGVVPQADNATPSER FEGPYTDFTPWTTEEQKLLEQALKTYPVNTPERWEKIAEAVPGRTKKDCMKRYKELVEMVKAKKAAQEQV LNASRAKK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 65.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001123359 |
Locus ID | 27000 |
UniProt ID | Q99543 |
Cytogenetics | 7q22.1 |
Refseq ORF | 1704 |
Synonyms | MPHOSPH11; MPP11; ZRF1; ZUO1 |
Summary | This gene is a member of the M-phase phosphoprotein (MPP) family. The gene encodes a phosphoprotein with a J domain and a Myb DNA-binding domain which localizes to both the nucleus and the cytosol. The protein is capable of forming a heterodimeric complex that associates with ribosomes, acting as a molecular chaperone for nascent polypeptide chains as they exit the ribosome. This protein was identified as a leukemia-associated antigen and expression of the gene is upregulated in leukemic blasts. Also, chromosomal aberrations involving this gene are associated with primary head and neck squamous cell tumors. This gene has a pseudogene on chromosome 6. Alternatively spliced variants which encode different protein isoforms have been described. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415322 | DNAJC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC427071 | DNAJC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415322 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 2 (DNAJC2), transcript variant 1 |
CNY 4840.00 |
|
LY427071 | Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 2 (DNAJC2), transcript variant 2 |
CNY 3080.00 |
|
PH325965 | DNAJC2 MS Standard C13 and N15-labeled recombinant protein (NP_001123359) |
CNY 19520.00 |