SPATA24 (NM_194296) Human Recombinant Protein
CAT#: TP326669
Recombinant protein of human hypothetical protein LOC202051 (LOC202051), 20 µg
View other "SPATA24" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC226669 representing NM_194296
Red=Cloning site Green=Tags(s) MATPLGWSKAGSGSVCLALDQLRDVIESQEELIHQLRNVMVLQDENFVSKEEFQAVEKKLVEEKAAHAKT KVLLAKEEEKLQFALGEVEVLSKQLEKEKLAFEKALSSVKSKVLQESSKKDQLITKCNEIESHIIKQEDI LNGKENEIKELQQVISQQKQIFRNHMSDFRIQKQQESYMAQVLDQKHKKASGTRQARSHQHPREK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 23.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_919272 |
| Locus ID | 202051 |
| UniProt ID | Q86W54 |
| Cytogenetics | 5q31.2 |
| Refseq ORF | 615 |
| Synonyms | CCDC161; T6441 |
| Summary | Binds DNA with high affinity but does not bind to TATA boxes. Synergises with GMNN and TBP in activation of TATA box-containing promoters and with GMNN and TBPL1 in activation of the NF1 TATA-less promoter. May play a role in cytoplasm movement and removal during spermiogenesis (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC430677 | SPATA24 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY430677 | Transient overexpression lysate of spermatogenesis associated 24 (SPATA24) |
CNY 3080.00 |
|
| PH326669 | SPATA24 MS Standard C13 and N15-labeled recombinant protein (NP_919272) |
CNY 19520.00 |
其它SPATA24产品
