NCOA4 (NM_001145262) Human Recombinant Protein
CAT#: TP326691
Purified recombinant protein of Homo sapiens nuclear receptor coactivator 4 (NCOA4), transcript variant 3, 20 µg
View other "NCOA4" proteins (10)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC226691 protein sequence
Red=Cloning site Green=Tags(s) MNTFQDQSGSSSNREPLLRCSDARRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHLECLRSREVWL YEQVDLIYQLKEETLQQQAQQLYSLLGQFNCLTHQLECTQNKDLANQVSVCLERLGSLTLKPEDSTVLLF EADTITLRQTITTFGSLKTIQIPEHLMAHASSANIGPFLEKRGCISMPEQKSASGIVAVPFSEWLLGSKP ASGYQAPYIPSTDPQDWLTQKQTLENSQTSSRACNFFNNVGGNLKGLENWLLKSEKSSYQKCNSHSTTSS FSIEMEKVGDQELPDQDEMDLSDWLVTPQESHKLRKPENGSRETSEKFKLLFQSYNVNDWLVKTDSCTNC QGNQPKGVEIENLGNLKCLNDHLEAKKPLSTPSMVTEDWLVQNHQDPCKVEEVCRANEPCTSFAECVCDE NCEKEALYKWLLKKEGKDKNGMPVEPKPEPEKHKDSLNMWLCPRKEVIEQTKAPKAMTPSRIADSFQVIK NSPLSEWLIRPPYKEGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWL LRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 69.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001138734 |
| Locus ID | 8031 |
| UniProt ID | Q13772 |
| Refseq Size | 3588 |
| Cytogenetics | 10q11.22 |
| Refseq ORF | 1842 |
| Synonyms | ARA70; ELE1; PTC3; RFG |
| Summary | This gene encodes an androgen receptor coactivator. The encoded protein interacts with the androgen receptor in a ligand-dependent manner to enhance its transcriptional activity. Chromosomal translocations between this gene and the ret tyrosine kinase gene, also located on chromosome 10, have been associated with papillary thyroid carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes are present on chromosomes 4, 5, 10, and 14. [provided by RefSeq, Feb 2009] |
| Protein Families | Druggable Genome, Transcription Factors |
| Protein Pathways | Pathways in cancer, Thyroid cancer |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401665 | NCOA4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428770 | NCOA4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428771 | NCOA4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401665 | Transient overexpression lysate of nuclear receptor coactivator 4 (NCOA4), transcript variant 5 |
CNY 3080.00 |
|
| LY428770 | Transient overexpression lysate of nuclear receptor coactivator 4 (NCOA4), transcript variant 3 |
CNY 3080.00 |
|
| LY428771 | Transient overexpression lysate of nuclear receptor coactivator 4 (NCOA4), transcript variant 4 |
CNY 3080.00 |
|
| PH301606 | NCOA4 MS Standard C13 and N15-labeled recombinant protein (NP_005428) |
CNY 19520.00 |
|
| PH326691 | NCOA4 MS Standard C13 and N15-labeled recombinant protein (NP_001138734) |
CNY 14250.00 |
|
| TP301606 | Recombinant protein of human nuclear receptor coactivator 4 (NCOA4), transcript variant 5, 20 µg |
CNY 2900.00 |
|
| TP762383 | Purified recombinant protein of Human nuclear receptor coactivator 4 (NCOA4), transcript variant 1, Ser280-Ala553, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1950.00 |
