NKIRAS2 (NM_001144927) Human Recombinant Protein
CAT#: TP326742
Purified recombinant protein of Homo sapiens NFKB inhibitor interacting Ras-like 2 (NKIRAS2), transcript variant 3, 20 µg
View other "NKIRAS2" proteins (12)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC226742 protein sequence
Red=Cloning site Green=Tags(s) MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQVRFYDTRGLRDGAE LPRHCFSCTDGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQRRVDPDVAQHWAK SEKVKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 21.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001138399 |
| Locus ID | 28511 |
| UniProt ID | Q9NYR9 |
| Refseq Size | 2493 |
| Cytogenetics | 17q21.2 |
| Refseq ORF | 573 |
| Synonyms | kappaB-Ras2; KBRAS2 |
| Summary | Atypical Ras-like protein that acts as a potent regulator of NF-kappa-B activity by preventing the degradation of NF-kappa-B inhibitor beta (NFKBIB) by most signals, explaining why NFKBIB is more resistant to degradation. May act by blocking phosphorylation of NFKBIB and nuclear localization of p65/RELA NF-kappa-B subunit. It is unclear whether it acts as a GTPase. Both GTP- and GDP-bound forms block phosphorylation of NFKBIB (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413685 | NKIRAS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424331 | NKIRAS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425022 | NKIRAS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428581 | NKIRAS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413685 | Transient overexpression lysate of NFKB inhibitor interacting Ras-like 2 (NKIRAS2), transcript variant 2 |
CNY 3080.00 |
|
| LY424331 | Transient overexpression lysate of NFKB inhibitor interacting Ras-like 2 (NKIRAS2), transcript variant 1 |
CNY 3080.00 |
|
| LY428581 | Transient overexpression lysate of NFKB inhibitor interacting Ras-like 2 (NKIRAS2), transcript variant 3 |
CNY 3080.00 |
|
| PH309464 | NKIRAS2 MS Standard C13 and N15-labeled recombinant protein (NP_060065) |
CNY 19520.00 |
|
| PH323273 | NKIRAS2 MS Standard C13 and N15-labeled recombinant protein (NP_001001349) |
CNY 19520.00 |
|
| PH326742 | NKIRAS2 MS Standard C13 and N15-labeled recombinant protein (NP_001138399) |
CNY 14250.00 |
|
| TP309464 | Recombinant protein of human NFKB inhibitor interacting Ras-like 2 (NKIRAS2), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP323273 | Recombinant protein of human NFKB inhibitor interacting Ras-like 2 (NKIRAS2), transcript variant 1, 20 µg |
CNY 2900.00 |
其它NKIRAS2产品
