RNASEH2B (NM_001142279) Human Recombinant Protein
CAT#: TP326833
Recombinant protein of human ribonuclease H2, subunit B (RNASEH2B), transcript variant 2, 20 µg
View other "RNASEH2B" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC226833 representing NM_001142279
Red=Cloning site Green=Tags(s) MAAGVDCGDGVGARQHVFLVSEYLKDASKKMKNGLMFVKLVNPCSGEGAIYLFNMCLQQLFEVKVFKEKH HSWFINQSVQSGGLLHFATPVDPLFLLLHYLIKADKEGKFQPLDQVVVDNVFPNCILLLKLPGLEKLLHH VTEEKGNPEIDNKKYYKYSKEKTLKWLEKKVNQTVAALKTNNVNVSSRVQSTAFFSGDQASTDKEEDYIR YAHGLISDYIPKELSDDLSKYLKLPEPSASLPNPPSKMAAQRQKRGK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001135751 |
Locus ID | 79621 |
UniProt ID | Q5TBB1 |
Cytogenetics | 13q14.3 |
Refseq ORF | 771 |
Synonyms | AGS2; DLEU8 |
Summary | RNase H2 is composed of a single catalytic subunit (A) and two non-catalytic subunits (B and C) and specifically degrades the RNA of RNA:DNA hybrids. The protein encoded by this gene is the non-catalytic B subunit of RNase H2, which is thought to play a role in DNA replication. Multiple transcript variants encoding different isoforms have been found for this gene. Defects in this gene are a cause of Aicardi-Goutieres syndrome type 2 (AGS2). [provided by RefSeq, Nov 2008] |
Protein Pathways | DNA replication |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411236 | RNASEH2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428003 | RNASEH2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411236 | Transient overexpression lysate of ribonuclease H2, subunit B (RNASEH2B), transcript variant 1 |
CNY 3080.00 |
|
LY428003 | Transient overexpression lysate of ribonuclease H2, subunit B (RNASEH2B), transcript variant 2 |
CNY 3080.00 |
|
PH326833 | RNASEH2B MS Standard C13 and N15-labeled recombinant protein (NP_001135751) |
CNY 19520.00 |
其它RNASEH2B产品