EDC3 (NM_001142443) Human Recombinant Protein
CAT#: TP326857
Recombinant protein of human enhancer of mRNA decapping 3 homolog (S. cerevisiae) (EDC3), transcript variant 1, 20 µg
View other "EDC3" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 6281.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC226857 protein sequence
Red=Cloning site Green=Tags(s) MATDWLGSIVSINCGDSLGVYQGRVSAVDQVSQTISLTRPFHNGVKCLVPEVTFRAGDITELKILEIPGP GDNQHFGDLHQTELGPSGAGCQVGINQNGTGKFVKKPASSSSAPQNIPKRTDVKSQDVAVSPQQQQCSKS YVDRHMESLSQSKSFRRRHNSWSSSSRHPNQATPKKSGLKNGQMKNKDDECFGDDIEEIPDTDFDFEGNL ALFDKAAVFEEIDTYERRSGTRSRGIPNERPTRYRHDENILESEPIVYRRIIVPHNVSKEFCTDSGLVVP SISYELHKKLLSVAEKHGLTLERRLEMTGVCASQMALTLLGGPNRLNPKNVHQRPTVALLCGPHVKGAQG ISCGRHLANHDVQVILFLPNFVKMLESITNELSLFSKTQGQQVSSLKDLPTSPVDLVINCLDCPENVFLR DQPWYKAAVAWANQNRAPVLSIDPPVHEVEQGIDAKWSLALGLPLPLGEHAGRIYLCDIGIPQQVFQEVG INYHSPFGCKFVIPLHSA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 55.9 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001135915 |
Locus ID | 80153 |
UniProt ID | Q96F86 |
Refseq Size | 4086 |
Cytogenetics | 15q24.1 |
Refseq ORF | 1524 |
Synonyms | hYjeF_N2-15q23; LSM16; MRT50; YJDC; YJEFN2 |
Summary | This gene encodes a protein that is important in mRNA degradation. The encoded protein is a component of a decapping complex that promotes efficient removal of the monomethylguanosine (m7G) cap from mRNAs, as part of the 5' to 3' mRNA decay pathway. Mutations in this gene have been identified in human patients with an autosomal recessive form of intellectual disability. [provided by RefSeq, May 2017] |
Protein Pathways | RNA degradation |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410908 | EDC3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428097 | EDC3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428098 | EDC3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410908 | Transient overexpression lysate of enhancer of mRNA decapping 3 homolog (S. cerevisiae) (EDC3), transcript variant 3 |
CNY 3080.00 |
|
LY428097 | Transient overexpression lysate of enhancer of mRNA decapping 3 homolog (S. cerevisiae) (EDC3), transcript variant 1 |
CNY 3080.00 |
|
LY428098 | Transient overexpression lysate of enhancer of mRNA decapping 3 homolog (S. cerevisiae) (EDC3), transcript variant 2 |
CNY 3080.00 |
|
PH302321 | EDC3 MS Standard C13 and N15-labeled recombinant protein (NP_079359) |
CNY 19520.00 |
|
PH326857 | EDC3 MS Standard C13 and N15-labeled recombinant protein (NP_001135915) |
CNY 19520.00 |
|
PH327114 | EDC3 MS Standard C13 and N15-labeled recombinant protein (NP_001135916) |
CNY 19520.00 |
|
TP302321 | Recombinant protein of human enhancer of mRNA decapping 3 homolog (S. cerevisiae) (EDC3), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP327114 | Recombinant protein of human enhancer of mRNA decapping 3 homolog (S. cerevisiae) (EDC3), transcript variant 2, 20 µg |
CNY 2900.00 |