GAS2 (NM_001143830) Human Recombinant Protein
CAT#: TP326863
Recombinant protein of human growth arrest-specific 2 (GAS2), transcript variant 3, 20 µg
View other "GAS2" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC226863 protein sequence
Red=Cloning site Green=Tags(s) MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEKLDNGALLCQL AETMQEKFKESMDANKPTKNLPLKKIPCKTSAPSGSFFARDNTANFLSWCRDLGVDETCLFESEGLVLHK QPREVCLCLLELGRIAARYGVEPPGLIKLEKEIEQEETLSAPSPSPSPSSKSSGKKSTGNLLDDAVKRIS EDPPCKCPNKFCVERLSQGRYRVGEKILFIRMLHNKHVMVRVGGGWETFAGYLLKHDPCRMLQISRVDGK TSPIQSKSPTLKDMNPDNYLVVSASYKAKKEIK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 34.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001137302 |
| Locus ID | 2620 |
| UniProt ID | O43903 |
| Refseq Size | 2240 |
| Cytogenetics | 11p14.3 |
| Refseq ORF | 939 |
| Synonyms | GAS-2 |
| Summary | The protein encoded by this gene is a caspase-3 substrate that plays a role in regulating microfilament and cell shape changes during apoptosis. It can also modulate cell susceptibility to p53-dependent apoptosis by inhibiting calpain activity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2017] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406084 | GAS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417420 | GAS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428373 | GAS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406084 | Transient overexpression lysate of growth arrest-specific 2 (GAS2), transcript variant 2 |
CNY 3080.00 |
|
| LY417420 | Transient overexpression lysate of growth arrest-specific 2 (GAS2), transcript variant 1 |
CNY 3080.00 |
|
| LY428373 | Transient overexpression lysate of growth arrest-specific 2 (GAS2), transcript variant 3 |
CNY 3080.00 |
|
| PH305912 | GAS2 MS Standard C13 and N15-labeled recombinant protein (NP_808221) |
CNY 19520.00 |
|
| PH323624 | GAS2 MS Standard C13 and N15-labeled recombinant protein (NP_005247) |
CNY 19520.00 |
|
| PH326863 | GAS2 MS Standard C13 and N15-labeled recombinant protein (NP_001137302) |
CNY 19520.00 |
|
| TP305912 | Recombinant protein of human growth arrest-specific 2 (GAS2), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP323624 | Recombinant protein of human growth arrest-specific 2 (GAS2), transcript variant 1, 20 µg |
CNY 2900.00 |
