LMO2 (NM_001142316) Human Recombinant Protein
CAT#: TP326864
Recombinant protein of human LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 3, 20 µg
View other "LMO2" proteins (14)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC226864 representing NM_001142316
Red=Cloning site Green=Tags(s) MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRR LYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINS DIVCEQDIYEWTKINGMI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 18.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001135788 |
| Locus ID | 4005 |
| UniProt ID | P25791 |
| Cytogenetics | 11p13 |
| Refseq ORF | 474 |
| Synonyms | LMO-2; RBTN2; RBTNL1; RHOM2; TTG2 |
| Summary | LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms.[provided by RefSeq, Nov 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417218 | LMO2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428033 | LMO2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428034 | LMO2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432149 | LMO2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417218 | Transient overexpression lysate of LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 1 |
CNY 3080.00 |
|
| LY428033 | Transient overexpression lysate of LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 2 |
CNY 3080.00 |
|
| LY428034 | Transient overexpression lysate of LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 3 |
CNY 3080.00 |
|
| LY432149 | Transient overexpression lysate of LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 1 |
CNY 3080.00 |
|
| PH305376 | LMO2 MS Standard C13 and N15-labeled recombinant protein (NP_005565) |
CNY 19520.00 |
|
| PH326762 | LMO2 MS Standard C13 and N15-labeled recombinant protein (NP_001135787) |
CNY 19520.00 |
|
| PH326864 | LMO2 MS Standard C13 and N15-labeled recombinant protein (NP_001135788) |
CNY 19520.00 |
|
| TP305376 | Recombinant protein of human LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP326762 | Recombinant protein of human LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP329124 | Recombinant protein of human LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 1, 20 µg |
CNY 2900.00 |
