ECHDC1 (NM_001139510) Human Recombinant Protein
CAT#: TP326894
Recombinant protein of human enoyl Coenzyme A hydratase domain containing 1 (ECHDC1), transcript variant 5, 20 µg
View other "ECHDC1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC226894 representing NM_001139510
Red=Cloning site Green=Tags(s) MALKQEMAKSLLKTASLSGRTKLLHQTGLSLYSTSHGFYEEEVKKTLQQFPGGSIDLQKEDNGIGILTLN NPSRMNAFSGVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVKSLGTPEDGMAVCMFMQNTL TRFMRLPLISVALVQGWALGGGAEFTTACDFRLMTPESKIRFVHKEMGIIPSWGGTTRLVEIIGSRQALK VLSGALKLDSKNALNIGMVEEVLQSSDETKSLEEAQEWLKQFIQGPPEVIRALKKSVCSGRELYLEEALQ NERDLLGTVWGGPANLEAIAKKGKFNK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001132982 |
Locus ID | 55862 |
UniProt ID | Q9NTX5 |
Cytogenetics | 6q22.33 |
Refseq ORF | 921 |
Synonyms | dJ351K20.2; HEL-S-76; MMCD |
Summary | Decarboxylases ethylmalonyl-CoA decarboxylase, a potentially toxic metabolite, to form butyryl-CoA, suggesting it might be involved in metabolite proofreading. Also has methylmalonyl-CoA decarboxylase activity at lower level.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC427974 | ECHDC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY427974 | Transient overexpression lysate of enoyl Coenzyme A hydratase domain containing 1 (ECHDC1), transcript variant 5 |
CNY 3080.00 |
|
PH326894 | ECHDC1 MS Standard C13 and N15-labeled recombinant protein (NP_001132982) |
CNY 19520.00 |