FXYD3 (NM_001136011) Human Recombinant Protein
CAT#: TP327235
Recombinant protein of human FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 7, 20 µg
View other "FXYD3" proteins (14)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC227235 protein sequence
Red=Cloning site Green=Tags(s) MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSG HHPGETPPLITPGSAQS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 7.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001129483 |
| Locus ID | 5349 |
| UniProt ID | Q14802 |
| Refseq Size | 1466 |
| Cytogenetics | 19q13.12 |
| Refseq ORF | 261 |
| Synonyms | MAT8; PLML |
| Summary | This gene belongs to a small family of FXYD-domain containing regulators of Na+/K+ ATPases which share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD, and containing 7 invariant and 6 highly conserved amino acids. This gene encodes a cell membrane protein that may regulate the function of ion-pumps and ion-channels. This gene may also play a role in tumor progression. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Oct 2008] |
| Protein Families | Ion Channels: Other, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411880 | FXYD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC416954 | FXYD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427762 | FXYD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427763 | FXYD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411880 | Transient overexpression lysate of FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 2 |
CNY 3080.00 |
|
| LY416954 | Transient overexpression lysate of FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 1 |
CNY 3080.00 |
|
| LY427762 | Transient overexpression lysate of FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 7 |
CNY 3080.00 |
|
| LY427763 | Transient overexpression lysate of FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 8 |
CNY 3080.00 |
|
| PH313945 | FXYD3 MS Standard C13 and N15-labeled recombinant protein (NP_005962) |
CNY 19520.00 |
|
| PH327235 | FXYD3 MS Standard C13 and N15-labeled recombinant protein (NP_001129483) |
CNY 19520.00 |
|
| PH327269 | FXYD3 MS Standard C13 and N15-labeled recombinant protein (NP_001129484) |
CNY 19520.00 |
|
| TP313945 | Recombinant protein of human FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP327269 | Recombinant protein of human FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 8, 20 µg |
CNY 2900.00 |
|
| TP761868 | Purified recombinant protein of Human FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2040.00 |
