BAP31 (BCAP31) (NM_001139457) Human Recombinant Protein
CAT＃: TP327334
Recombinant protein of human B-cell receptor-associated protein 31 (BCAP31), transcript variant 1, 20 µg
View other "BAP31" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC227334 representing NM_001139457
Red=Cloning site Green=Tags(s) MGAEASSSWCPGTALPEERLSVKRASEISGFLGQGSSGEAALDVLTHVLEGAGNKLTSSCGKPSSNRMSL QWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKY DDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESA SEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMR KQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 34.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001132929 |
| Locus ID | 10134 |
| UniProt ID | P51572 |
| Cytogenetics | Xq28 |
| Refseq ORF | 939 |
| Synonyms | 6C6-AG; BAP31; CDM; DDCH; DXS1357E |
| Summary | This gene encodes a member of the B-cell receptor associated protein 31 superfamily. The encoded protein is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi and in caspase 8-mediated apoptosis. Microdeletions in this gene are associated with contiguous ABCD1/DXS1375E deletion syndrome (CADDS), a neonatal disorder. Alternative splicing of this gene results in multiple transcript variants. Two related pseudogenes have been identified on chromosome 16. [provided by RefSeq, Jan 2012] |
| Protein Families | Druggable Genome, Transmembrane |
| Shipping | Dry Ice |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401750 | BCAP31 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427957 | BCAP31 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427962 | BCAP31 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401750 | Transient overexpression lysate of B-cell receptor-associated protein 31 (BCAP31), transcript variant 2 |
CNY 3080.00 |
|
| LY427957 | Transient overexpression lysate of B-cell receptor-associated protein 31 (BCAP31), transcript variant 3 |
CNY 3080.00 |
|
| LY427962 | Transient overexpression lysate of B-cell receptor-associated protein 31 (BCAP31), transcript variant 1 |
CNY 3080.00 |
|
| PH304804 | BCAP31 MS Standard C13 and N15-labeled recombinant protein (NP_005736) |
CNY 19520.00 |
|
| PH326633 | BCAP31 MS Standard C13 and N15-labeled recombinant protein (NP_001132913) |
CNY 19520.00 |
|
| PH327334 | BCAP31 MS Standard C13 and N15-labeled recombinant protein (NP_001132929) |
CNY 19520.00 |
|
| TP304804 | Recombinant protein of human B-cell receptor-associated protein 31 (BCAP31), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP326633 | Recombinant protein of human B-cell receptor-associated protein 31 (BCAP31), transcript variant 3, 20 µg |
CNY 2900.00 |
