NEDD4 2 (NEDD4L) (NM_001144964) Human Recombinant Protein
CAT#: TP327866
Purified recombinant protein of Homo sapiens neural precursor cell expressed, developmentally down-regulated 4-like (NEDD4L), transcript variant b, 20 µg
View other "NEDD4 2" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. | 
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC227866 representing NM_001144964 
Red=Cloning site Green=Tags(s) MERPYTFKDFLLRPRSHKSRVKGFLRLKMAYMPKNGGQDEENSDQRDDMEHGWEVVDSNDSASQHQEELP PPPLPPGWEEKVDNLGRTYYVNHNNRTTQWHRPSLMDVSSESDNNIRQINQEAAHRRFRSRRHISEDLEP EPSEGGDVPEPWETISEEVNIAGDSLGLALPPPPASPGSRTSPQELSEELSRRLQITPDSNGEQFSSLIQ REPSSRLRSCSVTDAVAEQGHLPPPSAPAGRARSSTVTGGEEPTPSVAYVHTTPGLPSGWEERKDAKGRT YYVNHNNRTTTWTRPIMQLAEDGASGSATNSNNHLIEPQIRRPRSLSSPTVTLSAPLEGAKDSPVRRAVK DTLSNPQSPQPSPYNSPKPQHKVTQSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLKFPVHMRSKTS LNPNDLGPLPPGWEERIHLDGRTFYIDHNSKITQWEDPRLQNPAITGPAVPYSREFKQKYDYFRKKLKKP ADIPNRFEMKLHRNNIFEESYRRIMSVKRPDVLKARLWIEFESEKGLDYGGVAREWFFLLSKEMFNPYYG LFEYSATDNYTLQINPNSGLCNEDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLGKQITLNDMES VDSEYYNSLKWILENDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQ KQMNAFLEGFTELLPIDLIKIFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLLMD AEKRIRLLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLREKL LMAVENAQGFEGVD myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 98 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_001138436 | 
| Locus ID | 23327 | 
| UniProt ID | Q96PU5 | 
| Refseq Size | 8436 | 
| Cytogenetics | 18q21.31 | 
| Refseq ORF | 2562 | 
| Synonyms | hNEDD4-2; NEDD4-2; NEDD4.2; PVNH7; RSP5 | 
| Summary | This gene encodes a member of the Nedd4 family of HECT domain E3 ubiquitin ligases. HECT domain E3 ubiquitin ligases transfer ubiquitin from E2 ubiquitin-conjugating enzymes to protein substrates, thus targeting specific proteins for lysosomal degradation. The encoded protein mediates the ubiquitination of multiple target substrates and plays a critical role in epithelial sodium transport by regulating the cell surface expression of the epithelial sodium channel, ENaC. Single nucleotide polymorphisms in this gene may be associated with essential hypertension. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Mar 2012] | 
| Protein Families | Druggable Genome | 
| Protein Pathways | Endocytosis, Ubiquitin mediated proteolysis | 
Citations (1)
| The use of this Proteins has been cited in the following citations: | 
|---|
| 
                                                E3 ligase Nedd4l promotes antiviral innate immunity by catalyzing K29-linked cysteine ubiquitination of TRAF3
                                                ,Gao, P;Ma, X;Yuan, M;Yi, Y;Liu, G;Wen, M;Jiang, W;Ji, R;Zhu, L;Tang, Z;Yu, Q;Xu, J;Yang, R;Xia, S;Yang, M;Pan, J;Yuan, H;An, H;,
                                                Nature communications
                                                ,PubMed ID 33608556
                                                [NEDD4L]
                                                 | 
                                        
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC428611 | NEDD4L HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 1470.00  | 
                                            |
| LY428611 | Transient overexpression lysate of neural precursor cell expressed, developmentally down-regulated 4-like (NEDD4L), transcript variant b | 
                                                     CNY 4840.00  | 
                                            |
| PH327866 | NEDD4L MS Standard C13 and N15-labeled recombinant protein (NP_001138436) | 
                                                     CNY 14250.00  | 
                                            
其它NEDD4 2产品
