Small integral membrane protein 6 (SMIM6) (NM_001162997) Human Recombinant Protein
CAT#: TP328023L
Recombinant protein of human hypothetical protein LOC100130933 (LOC100130933), 1 mg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36000.00
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC228023 representing NM_001162997
Red=Cloning site Green=Tags(s) MDQLVFKETIWNDAFWQNPWDQGGLAVIILFITAVLLLILFAIVFGLLTSTENTQCEAGEEE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 6.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001156469 |
| Locus ID | 100130933 |
| UniProt ID | P0DI80 |
| Cytogenetics | 17q25.1 |
| Refseq ORF | 186 |
| Synonyms | C17orf110; ELN |
Documents
| FAQs |
| SDS |
其它Small integral membrane protein 6产品
