Gasdermin like (GSDMB) (NM_001165958) Human Recombinant Protein
CAT#: TP328330
Recombinant protein of human gasdermin B (GSDMB), transcript variant 3, 20 µg
View other "Gasdermin like" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC228330 representing NM_001165958
Red=Cloning site Green=Tags(s) MFSVFEEITRIVVKEMDAGGDMIAVRSLVDADRFRCFHLVGEKRTFFGCRHYTTGLTLMDILDTDGDKWL DELDSGLQGQKAEFQILDNVDSTGELIVRLPKEITISGSFQGFHHQKIKISENRISQQYLATLENRKLKR ELPFSFRSINTRENLYLVTETLETVKEETLKSDRQYKFWSQISQGHLSYKHKGQREVTIPPNRVLSYRVK QLVFPNKETMNIHFRGKTKSFPEEKDGASSCLGKSLGSEDSRNMKEKLEDMESVLKDLTEEKRKDVLNSL AKCLGKEDIRQDLEQRVSEVLISGELHMEDPDKPLLSSLFNAAGVLVEARAKAILDFLDALLELSEEQQF VAEALEKGTLPLLKDQVKSVMEQNWDELASSPPDMDYDPEARILCALYVVVSILLELAEGPTSVSS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 47.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001159430 |
| Locus ID | 55876 |
| UniProt ID | Q8TAX9 |
| Cytogenetics | 17q21.1 |
| Refseq ORF | 1248 |
| Synonyms | GSDMB-1; GSDML; PP4052; PRO2521 |
| Summary | This gene encodes a member of the gasdermin-domain containing protein family. Other gasdermin-family genes are implicated in the regulation of apoptosis in epithelial cells, and are linked to cancer. Alternative splicing and the use of alternative promoters results in multiple transcript variants. Additional variants have been described, but they are candidates for nonsense-mediated mRNA decay (NMD) and are unlikely to be protein-coding. [provided by RefSeq, Nov 2016] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC420925 | GSDMB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431353 | GSDMB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431358 | GSDMB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY420925 | Transient overexpression lysate of gasdermin B (GSDMB), transcript variant 1 |
CNY 3080.00 |
|
| LY431353 | Transient overexpression lysate of gasdermin B (GSDMB), transcript variant 4 |
CNY 3080.00 |
|
| LY431358 | Transient overexpression lysate of gasdermin B (GSDMB), transcript variant 3 |
CNY 3080.00 |
其它Gasdermin like产品
