Argonaute 2 (AGO2) (NM_001164623) Human Recombinant Protein
CAT#: TP328592
Purified recombinant protein of Homo sapiens eukaryotic translation initiation factor 2C, 2 (EIF2C2), transcript variant 2, 20 µg
View other "Argonaute 2" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC228592 representing NM_001164623
Red=Cloning site Green=Tags(s) MYSGAGPALAPPAPPPPIQGYAFKPPPRPDFGTSGRTIKLQANFFEMDIPKIDIYHYELDIKPEKCPRRV NREIVEHMVQHFKTQIFGDRKPVFDGRKNLYTAMPLPIGRDKVELEVTLPGEGKDRIFKVSIKWVSCVSL QALHDALSGRLPSVPFETIQALDVVMRHLPSMRYTPVGRSFFTASEGCSNPLGGGREVWFGFHQSVRPSL WKMMLNIDVSATAFYKAQPVIEFVCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQMKRKYR VCNVTRRPASHQTFPLQQESGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQ RCIKKLTDNQTSTMIRATARSAPDRQEEISKLMRSASFNTDPYVREFGIMVKDEMTDVTGRVLQPPSILY GGRNKAIATPVQGVWDMRNKQFHTGIEIKVWAIACFAPQRQCTEVHLKSFTEQLRKISRDAGMPIQGQPC FCKYAQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMKNVQRTTPQTL SNLCLKINVKLGGVNNILLPQGRPPVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPNRYCATVR VQQHRQEIIQDLAAMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQP GITFIVVQKRHHTRLFCTDKNERGTSRPSHYHVLWDDNRFSSDELQILTYQLCHTYVRCTRSVSIPAPAY YAHLVAFRARYHLVDKEHDSAEGSHTSGQSNGRDHQALAKAVQVHQDTLRTMYFA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 93.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | Enzyme activity (PMID: 28769054) |
| Reference Data | |
| RefSeq | NP_001158095 |
| Locus ID | 27161 |
| UniProt ID | Q9UKV8 |
| Cytogenetics | 8q24.3 |
| Refseq ORF | 2475 |
| Synonyms | CASC7; EIF2C2; LESKRES; LINC00980; PPD; Q10 |
| Summary | This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009] |
| Protein Families | Druggable Genome |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
An alternative microRNA-mediated post-transcriptional regulation of GADD45A by p53 in human non-small-cell lung cancer cells
,Li, J;Dong, J;Li, S;Xia, W;Su, X;Qin, X;Chen, Y;Ding, H;Li, H;Huang, A;Bai, C;Hu, T;Wang, C;Chu, B;Shao, N;,
Sci Rep
,PubMed ID 28769054
[Argonaute 2]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415922 | AGO2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC431620 | AGO2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY415922 | Transient overexpression lysate of eukaryotic translation initiation factor 2C, 2 (EIF2C2), transcript variant 1 |
CNY 4840.00 |
|
| LY431620 | Transient overexpression lysate of eukaryotic translation initiation factor 2C, 2 (EIF2C2), transcript variant 2 |
CNY 4840.00 |
其它Argonaute 2产品


