FXYD6 (NM_001164836) Human Recombinant Protein
CAT#: TP328721M
Purified recombinant protein of Homo sapiens FXYD domain containing ion transport regulator 6 (FXYD6), transcript variant 4, 100 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 9998.00
货期*
4周
规格
推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC228721 protein sequence
Red=Cloning site Green=Tags(s) MELVLVFLCSLLAPMVLASAAEKEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPR APGDEEAQVENLITANATEPQKAEN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 10.4 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001158308 |
| Locus ID | 53826 |
| UniProt ID | Q9H0Q3 |
| Refseq Size | 2229 |
| Cytogenetics | 11q23.3 |
| Refseq ORF | 285 |
| Summary | This gene encodes a member of the FXYD family of transmembrane proteins. This particular protein encodes phosphohippolin, which likely affects the activity of Na,K-ATPase. Multiple alternatively spliced transcript variants encoding the same protein have been described. Related pseudogenes have been identified on chromosomes 10 and X. Read-through transcripts have been observed between this locus and the downstream sodium/potassium-transporting ATPase subunit gamma (FXYD2, GeneID 486) locus.[provided by RefSeq, Feb 2011] |
| Protein Families | Ion Channels: Other, Transmembrane |
Documents
| FAQs |
| SDS |
You may also need
Customer
Reviews
Loading...
