RAB7B (NM_001164522) Human Recombinant Protein
CAT#: TP328755
Recombinant protein of human RAB7B, member RAS oncogene family (RAB7B), transcript variant 2, 20 µg
View other "RAB7B" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC228755 protein sequence
Red=Cloning site Green=Tags(s) MNPRKKVDLKLIIVGAIGVGKTSLLHQYVHKTFYEEYQTTLGASILSKIIILGDTTLKLQIWDTGGQERF RSMVSTFYKGSDGCILAFDVTDLESFEALDIWRGDVLAKIVPMEQSYPMVLLGNKIDLADRKVPQEVAQG WCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILENHLTESIKLSPDQSRSRCC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 22.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001157994 |
| Locus ID | 338382 |
| UniProt ID | Q96AH8 |
| Refseq Size | 2958 |
| Cytogenetics | 1q32.1 |
| Refseq ORF | 597 |
| Synonyms | RAB7 |
| Summary | Controls vesicular trafficking from endosomes to the trans-Golgi network (TGN). Acts as a negative regulator of TLR9 signaling and can suppress TLR9-triggered TNFA, IL6, and IFNB production in macrophages by promoting TLR9 lysosomal degradation. Also negatively regulates TLR4 signaling in macrophages by promoting lysosomal degradation of TLR4. Promotes megakaryocytic differentiation by increasing NF-kappa-B-dependent IL6 production and subsequently enhancing the association of STAT3 with GATA1. Not involved in the regulation of the EGF- and EGFR degradation pathway.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406153 | RAB7B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431783 | RAB7B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406153 | Transient overexpression lysate of RAB7B, member RAS oncogene family (RAB7B), transcript variant 1 |
CNY 3080.00 |
|
| LY431783 | Transient overexpression lysate of RAB7B, member RAS oncogene family (RAB7B), transcript variant 2 |
CNY 3080.00 |
|
| PH302283 | RAB7B MS Standard C13 and N15-labeled recombinant protein (NP_796377) |
CNY 19520.00 |
|
| TP302283 | Recombinant protein of human RAB7B, member RAS oncogene family (RAB7B), 20 µg |
CNY 2900.00 |
