TBX20 (NM_001166220) Human Recombinant Protein
CAT#: TP328815
Recombinant protein of human T-box 20 (TBX20), transcript variant 2, 20 µg
View other "TBX20" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC228815 protein sequence
Red=Cloning site Green=Tags(s) MEFTASPKPQLSSRANAFSIAALMSSGGSKEKEATENTIKPLEQFVEKSSCAQPLGELTSLDAHGEFGGG SGSSPSSSSLCTEPLIPTTPIIPSEEMAKIACSLETKELWDKFHELGTEMIITKSGRRMFPTIRVSFSGV DPEAKYIVLMDIVPVDNKRYRYAYHRSSWLVAGKADPPLPARLYVHPDSPFTGEQLLKQMVSFEKVKLTN NELDQHGHIILNSMHKYQPRVHIIKKKDHTASLLNLKSEEFRTFIFPETVFTAVTAYQNQLITKLKIDSN PFAKGFRDSSRLTDIER myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 33 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001159692 |
| Locus ID | 57057 |
| UniProt ID | Q9UMR3 |
| Refseq Size | 1374 |
| Cytogenetics | 7p14.2 |
| Refseq ORF | 891 |
| Synonyms | ASD4 |
| Summary | This gene encodes a T-box family member. The T-box family members share a common DNA binding domain, termed the T-box, and they are transcription factors involved in the regulation of developmental processes. This gene is essential for heart development. Mutations in this gene are associated with diverse cardiac pathologies, including defects in septation, valvulogenesis and cardiomyopathy. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2009] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC421469 | TBX20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC431843 | TBX20 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY421469 | Transient overexpression lysate of T-box 20 (TBX20), transcript variant 1 |
CNY 4840.00 |
|
| LY431843 | Transient overexpression lysate of T-box 20 (TBX20), transcript variant 2 |
CNY 3080.00 |
|
| TP762422 | Purified recombinant protein of Human T-box 20 (TBX20), transcript variant 1, Met1-Thr340, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1950.00 |
