Aquaporin 1 (AQP1) (NM_001185062) Human Recombinant Protein
CAT#: TP329599
Purified recombinant protein of Homo sapiens aquaporin 1 (Colton blood group) (AQP1), transcript variant 4, 20 µg
View other "Aquaporin 1" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC229599 representing NM_001185062
Red=Cloning site Green=Tags(s) MQSGMGWNVLDFWLADGVNSGQGLGIEIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAID YTGCGINPARSFGSAVITHNFSNHWIFWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDL DADDINSRVEMKPK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.1 |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001171991 |
Locus ID | 358 |
UniProt ID | P29972 |
Cytogenetics | 7p14.3 |
Refseq ORF | 462 |
Synonyms | AQP-CHIP; CHIP28; CO |
Summary | This gene encodes a small integral membrane protein with six bilayer spanning domains that functions as a water channel protein. This protein permits passive transport of water along an osmotic gradient. This gene is a possible candidate for disorders involving imbalance in ocular fluid movement. [provided by RefSeq, Aug 2016] |
Protein Families | Druggable Genome, Ion Channels: Other, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403670 | AQP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403670 | Transient overexpression lysate of aquaporin 1 (Colton blood group) (AQP1) |
CNY 3080.00 |
|
PH305304 | AQP1 MS Standard C13 and N15-labeled recombinant protein (NP_932766) |
CNY 19520.00 |
|
TP305304 | Recombinant protein of human aquaporin 1 (Colton blood group) (AQP1), 20 µg |
CNY 2900.00 |
其它Aquaporin 1产品