CITED2 (NM_001168388) Human Recombinant Protein
CAT#: TP329801
Purified recombinant protein of Homo sapiens Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 2 (CITED2), transcript variant 2, 20 µg
View other "CITED2" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC229801 representing NM_001168388
Red=Cloning site Green=Tags(s) MADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHQQQQPQHAFNALMGEHIHYGAGNMNATSGIR HAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVASQGGSLPASMQLQKLNNQYFNHHPYPHNHYMPDLHP AAGHQMNGTNQHFRDCNPKHSGGSSTPGGSGGSSTPGGSGSSSGGGAGSSNSGGGSGSGNMPASVAHVPA AMLPPNVIDTDFIDEEVLMSLVIEMGLDRIKELPELWLGQNEFDFMTDFVCKQQPSRVSC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 28.9 |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001161860 |
| Locus ID | 10370 |
| UniProt ID | Q99967 |
| Cytogenetics | 6q24.1 |
| Refseq ORF | 810 |
| Synonyms | ASD8; MRG-1; MRG1; P35SRJ; VSD2 |
| Summary | The protein encoded by this gene inhibits transactivation of HIF1A-induced genes by competing with binding of hypoxia-inducible factor 1-alpha to p300-CH1. Mutations in this gene are a cause of cardiac septal defects. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2012] |
| Protein Families | Druggable Genome, Transcription Factors |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Aberrant expression of CITED2 promotes prostate cancer metastasis by activating the nucleolin-AKT pathway
,Shin, SH;Lee, GY;Lee, M;Kang, J;Shin, HW;Chun, YS;Park, JW;,
Nat Commun
,PubMed ID 30291252
[CITED2]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416876 | CITED2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC432801 | CITED2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416876 | Transient overexpression lysate of Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 2 (CITED2), transcript variant 1 |
CNY 3080.00 |
|
| LY432801 | Transient overexpression lysate of Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 2 (CITED2), transcript variant 2 |
CNY 3080.00 |
|
| TP760894 | Purified recombinant protein of Human Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 2 (CITED2), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
