CD244 (NM_001166664) Human Recombinant Protein
CAT#: TP329806
Purified recombinant protein of Homo sapiens CD244 molecule, natural killer cell receptor 2B4 (CD244), transcript variant 3, 20 µg
View other "CD244" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC229806 representing NM_001166664
Red=Cloning site Green=Tags(s) MLGQVVTLILLLLLKVYQGKGCQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWE NGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFEFRFWPFLVIIVIL SALFLGTLACFCVWRRKRKEKQSETSPKEFLTIYEDVKDLKTRRNHEQEQTFPGGGSTIYSMIQSQSSAP TSQEPAYTLYSLIQPSRKSGSRKRNHSPSFNSTIYEVIGKSQPKAQNPARLSRKELENFDVYS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 31.2 |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001160136 |
Locus ID | 51744 |
UniProt ID | Q9BZW8 |
Cytogenetics | 1q23.3 |
Refseq ORF | 819 |
Synonyms | 2B4; NAIL; NKR2B4; Nmrk; SLAMF4 |
Summary | This gene encodes a cell surface receptor expressed on natural killer (NK) cells (and some T cells) that mediate non-major histocompatibility complex (MHC) restricted killing. The interaction between NK-cell and target cells via this receptor is thought to modulate NK-cell cytolytic activity. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2009] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Protein Pathways | Natural killer cell mediated cytotoxicity |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413990 | CD244 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432954 | CD244 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413990 | Transient overexpression lysate of CD244 molecule, natural killer cell receptor 2B4 (CD244), transcript variant 1 |
CNY 3080.00 |
|
LY432954 | Transient overexpression lysate of CD244 molecule, natural killer cell receptor 2B4 (CD244), transcript variant 2 |
CNY 3080.00 |
|
PH306988 | CD244 MS Standard C13 and N15-labeled recombinant protein (NP_057466) |
CNY 19520.00 |
|
TP306988 | Recombinant protein of human CD244 molecule, natural killer cell receptor 2B4 (CD244), 20 µg |
CNY 2900.00 |
|
TP723933 | Human 2B4 Protein, mFc-His Tag |
CNY 5552.00 |
|
TP724012 | Human 2B4 Protein, hFc tag |
CNY 5876.00 |