CELF3 (NM_001172649) Human Recombinant Protein
CAT#: TP330039
Purified recombinant protein of Homo sapiens CUGBP, Elav-like family member 3 (CELF3), transcript variant 3, 20 µg
View other "CELF3" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC230039 representing NM_001172649
Red=Cloning site Green=Tags(s) MKEPDAIKLFVGQIPRHLEEKDLKPIFEQFGRIFELTVIKDKYTGLHKGCAFLTYCARDSALKAQSALHE QKTLPGMNRPIQVKPADSESRGEDRKLFVGMLGKQQTDEDVRKMFEPFGTIDECTVLRGPDGTSKGCAFV KFQTHAEAQAAINTLHSSRTLPGASSSLVVKFADTEKERGLRRMQQVATQLGMFSPIALQFGAYSAYTQA LMQQQAALVAAHSAYLSPMATMAAVQMQHMAAINANGLIATPITPSSAQSPAAPVDPLQQAYAGMQHYTA AYPAAYSLVAPAFPQPPALVAQQPPPPPQQQQQQQQQQQQQQQREGPDGCNIFIYHLPQEFTDSEILQMF VPFGHVISAKVFVDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDANRPY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 46.1 |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001166120 |
| Locus ID | 11189 |
| UniProt ID | Q5SZQ8 |
| Cytogenetics | 1q21.3 |
| Refseq ORF | 1245 |
| Synonyms | BRUNOL1; CAGH4; ERDA4; ETR-1; TNRC4 |
| Summary | Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Multiple alternatively spliced transcript variants encoding different isoforms have been identified in this gene. [provided by RefSeq, Feb 2010] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416136 | CELF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433039 | CELF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416136 | Transient overexpression lysate of trinucleotide repeat containing 4 (TNRC4) |
CNY 3080.00 |
|
| LY433039 | Transient overexpression lysate of CUGBP, Elav-like family member 3 (CELF3), transcript variant 3 |
CNY 3080.00 |
|
| PH308465 | CELF3 MS Standard C13 and N15-labeled recombinant protein (NP_009116) |
CNY 19520.00 |
|
| TP308465 | Recombinant protein of human trinucleotide repeat containing 4 (TNRC4), 20 µg |
CNY 2900.00 |
