MFAP4 (NM_001198695) Human Recombinant Protein
CAT#: TP331122
Recombinant protein of human microfibrillar-associated protein 4 (MFAP4), transcript variant 1, 20 µg
View other "MFAP4" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC231122 representing NM_001198695
Red=Cloning site Green=Tags(s) MGELSPLQRPLATEGTMKAQGVLLKLALLALPLLLLLSTPPCAPQVSGIRGDALERFCLQQPLDCDDIYA QGYQSDGVYLIYPSGPSVPVPVFCDMTTEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQN MHLLTLKQKYELRVDLEDFENNTAYAKYADFSISPNAVSAEEDGYTLFVAGFEDGGAGDSLSYHSGQKFS TFDRDQDLFVQNCAALSSGAFWFRSCHFANLNGFYLGGSHLSYANGINWAQWKGFYYSLKRTEMKIRRA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 31.6 |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001185624 |
| Locus ID | 4239 |
| UniProt ID | P55083 |
| Cytogenetics | 17p11.2 |
| Refseq ORF | 837 |
| Summary | This gene encodes a protein with similarity to a bovine microfibril-associated protein. The protein has binding specificities for both collagen and carbohydrate. It is thought to be an extracellular matrix protein which is involved in cell adhesion or intercellular interactions. The gene is located within the Smith-Magenis syndrome region. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2010] |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419346 | MFAP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434121 | MFAP4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419346 | Transient overexpression lysate of microfibrillar-associated protein 4 (MFAP4) |
CNY 3080.00 |
|
| LY434121 | Transient overexpression lysate of microfibrillar-associated protein 4 (MFAP4), transcript variant 1 |
CNY 3080.00 |
|
| PH308999 | MFAP4 MS Standard C13 and N15-labeled recombinant protein (NP_002395) |
CNY 19520.00 |
|
| TP308999 | Recombinant protein of human microfibrillar-associated protein 4 (MFAP4), 20 µg |
CNY 2900.00 |
