Atp6v0e (NM_025272) Mouse Recombinant Protein
CAT#: TP500150
Purified recombinant protein of Mouse ATPase, H+ transporting, lysosomal V0 subunit E (Atp6v0e), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR200150 protein sequence
Red=Cloning site Green=Tags(s) MAYHGLTVPLIVMSVFWGFVGLLVPWFIPKGPNRGVIITMLVTCSVCCYLFWLIAILAQLNPLFGPQLKN ETIWYLKYHWP myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 9.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079548 |
Locus ID | 11974 |
UniProt ID | Q9CQD8 |
Refseq Size | 800 |
Cytogenetics | 17 A3.3 |
Refseq ORF | 243 |
Synonyms | Atp6k; Atp6v0e1; M9.2 |
Summary | Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Atp6v0e产品