Sdhaf4 (NM_026503) Mouse Recombinant Protein
CAT#: TP500347
Purified recombinant protein of Mouse succinate dehydrogenase complex assembly factor 4 (Sdhaf4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
货期*
4周
规格
Product images
推荐一起购买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR200347 protein sequence
Red=Cloning site Green=Tags(s) MVSTTLSVSRMTFVWRAARPSLLNHSLRKMSYQEGKPEPAKQALKKSKLPLGRFDSLEDSPEEREPLQKF PDDVNPVTKEKGGPKGPEPTRYGDWERKGRCIDF myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 11.9 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_080779 |
| Locus ID | 68002 |
| UniProt ID | Q8BTE0 |
| Refseq Size | 675 |
| Cytogenetics | 1 A5 |
| Refseq ORF | 312 |
| Synonyms | 1110058L19Rik; 1700001E18Rik; C6orf57 |
| Summary | Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol (PubMed:24954416). Binds to the flavoprotein subunit Sdha in its FAD-bound form, blocking the generation of excess reactive oxigen species (ROS) and facilitating its assembly with the iron-sulfur protein subunit Sdhb into the SDH catalytic dimer (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
You may also need
Customer
Reviews
Loading...
