Pf4 (NM_019932) Mouse Recombinant Protein
CAT#: TP500359
Purified recombinant protein of Mouse platelet factor 4 (Pf4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
| Cited in 1 publication. |
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR200359 representing NM_019932
Red=Cloning site Green=Tags(s) MSVAAVFRGLRPSPELLLLGLLFLPAVVAVTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRH CAVPQLIATLKNGRKICLDRQAPLYKKVIEKILES myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 11.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_064316 |
| Locus ID | 56744 |
| UniProt ID | Q9Z126 |
| Refseq Size | 525 |
| Cytogenetics | 5 E1 |
| Refseq ORF | 315 |
| Synonyms | Cxcl4; Scyb4 |
| Summary | Released during platelet aggregation. Neutralizes the anticoagulant effect of heparin because it binds more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Chemotactic for neutrophils and monocytes. Inhibits endothelial cell proliferation (By similarity).[UniProtKB/Swiss-Prot Function] |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Critical role of CXCL4 in the lung pathogenesis of influenza (H1N1) respiratory infection.
,null,
Mucosal immunology
,PubMed ID 28120850
[Pf4]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| TP723860 | Purified recombinant protein of Mouse platelet factor 4 (Pf4 / PF-4) |
CNY 4090.00 |
