Atp5j (NM_016755) Mouse Recombinant Protein
CAT#: TP500403
Purified recombinant protein of Mouse ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F (Atp5j), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
货期*
4周
规格
Product images
推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR200403 protein sequence
Red=Cloning site Green=Tags(s) MVLQRIFRLSSVLRSAVSVHLKRNIGVTAVAFNKELDPVQKLFVDKIREYKSKRQASGGPVDIGPEYQQD LDRELYKLKQMYGKGEMDTFPTFKFDDPKFEVIDKPQS myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 12.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_058035 |
| Locus ID | 11957 |
| UniProt ID | P97450 |
| Refseq Size | 820 |
| Cytogenetics | 16 C3.3 |
| Refseq ORF | 324 |
| Synonyms | Atp5pf; CF6 |
| Summary | The protein encoded by this gene is a component of mitochondrial adenosine triphosphate synthase, which catalyzes the conversion of ATP from ADP. Mitochondrial adenosine triphosphate synthase consists of extrinsic and intrinsic membrane domains that are joined by a stalk. The protein encoded by this gene is a subunit of the stalk domain. A bi-directional promoter that drives expression of this gene has been has been identified. Pseudogenes of this gene are found on chromosomes 14 and 17. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014] |
Documents
| FAQs |
| SDS |
You may also need
Customer
Reviews
Loading...
