Cdk2ap2 (NM_026373) Mouse Recombinant Protein
CAT#: TP500685
Purified recombinant protein of Mouse CDK2-associated protein 2 (Cdk2ap2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR200685 protein sequence
Red=Cloning site Green=Tags(s) MSYKPIAPAPSSTPGSSTPGPGTPVPTAGSVPSPSGSVPGAAAPFRPLFNDFGPPSMGYVQAMKPPGSQG SQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 13.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_080649 |
| Locus ID | 52004 |
| UniProt ID | Q9CPY4 |
| Refseq Size | 911 |
| Cytogenetics | 19 A |
| Refseq ORF | 381 |
| Synonyms | 5830466O21Rik; D19Ertd144e; Doc-1r |
| Summary | Plays a role in regulating the self-renewal of embryonic stem cells (ESCs) and in maintaining cell survival during terminal differentiation of ESCs (PubMed:22548356). Regulates microtubule organization of metaphase II oocytes (PubMed:12944431). Inhibits cell cycle G1/S phase transition by repressing CDK2 expression and activation; represses CDK2 activation by inhibiting its interaction with cyclin E and A (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它Cdk2ap2产品
