Pea15a (NM_011063) Mouse Recombinant Protein

CAT#: TP500734

Purified recombinant protein of Mouse phosphoprotein enriched in astrocytes 15A (Pea15a), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2900.00


货期*
4周

规格
    • 20 ug

Product images

推荐一起购买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR200734 protein sequence
Red=Cloning site Green=Tags(s)

MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEIS
RRPDLLTMVVDYRTRVLKISEEEELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 15.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_035193
Locus ID 18611
UniProt ID Q62048
Refseq Size 2477
Cytogenetics 1 79.54 cM
Refseq ORF 390
Synonyms Mat; Mat1; Pea; PEA-; PEA-15; Pea15; Pkcs; Pkcs15
Summary This gene encodes an adaptor protein that functions as a negative regulator of apoptosis induced by tumor necrosis factor-alpha, tumor necrosis factor-related apoptosis-inducing ligand, and Fas, through its interaction with fas-associated protein with death domain and caspase-8. It also regulates proliferation signaling by relocating the extracellular signal-regulated protein kinases 1 and 2 to the cytosol. The protein encoded by this gene contains an N-terminal death effector domain and a long, flexible C-terminal tail. In humans, the encoded protein is an endogenous substrate for protein kinase C. This protein is overexpressed in type 2 diabetes mellitus, where it may contribute to insulin resistance in glucose uptake. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2016]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...