Tor1aip2 (NM_022329) Mouse Recombinant Protein
CAT#: TP500751
Purified recombinant protein of Mouse torsin A interacting protein 2 (Tor1aip2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR200751 protein sequence
Red=Cloning site Green=Tags(s) MFSDNSHCPDCGQQWFPSLELGHWLYQTELVENECYQVFLDRINRADYCPECYPDNPANRSLVLPWSFPL EWAPQNLTRWTFEKACHPFLLGPPLVRKKIHDSRVAGFNPALQLILSRTDKTLNKKLGQSK myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 15.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_071724 |
Locus ID | 240832 |
UniProt ID | Q9ER81 |
Refseq Size | 2585 |
Cytogenetics | 1 G3 |
Refseq ORF | 393 |
Synonyms | 15kDa; 1110020D10Rik; A130072J07; AA103493; AW060462; AW610675; C77739; Ifrg15; Lull1 |
Summary | Required for endoplasmic reticulum integrity. Regulates the distribution of TOR1A between the endoplasmic reticulum and the nuclear envelope as well as induces TOR1A, TOR1B and TOR3A ATPase activity (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Tor1aip2产品