Ppp1r11 (NM_029632) Mouse Recombinant Protein
CAT#: TP500757
Purified recombinant protein of Mouse protein phosphatase 1, regulatory inhibitor subunit 11 (Ppp1r11), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR200757 protein sequence
Red=Cloning site Green=Tags(s) MAETGAGISETVTETTVTETTVTETTEPENQSLIMKLRKRKPEKKVEWSSDTVDNEHMGRRSSKCCCIYE KPRAFGESSTESDEDEEEGCSHKHCVRGHRKGRRPTTPAPTPTTPPQPPDPSQPPPGPMQH myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 14.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_083908 |
Locus ID | 76497 |
UniProt ID | Q8K1L5 |
Refseq Size | 1696 |
Cytogenetics | 17 19.16 cM |
Refseq ORF | 393 |
Synonyms | 1500041B02Rik; AV117883; Hcgv; Tcte5; Tctex-5; Tctex5 |
Summary | Atypical E3 ubiquitin-protein ligase which ubiquitinates TLR2 at 'Lys-754' leading to its degradation by the proteasome. Plays a role in regulating inflammatory cytokine release and gram-positive bacterial clearance by functioning, in part, through the ubiquitination and degradation of TLR2 (PubMed:27805901). Inhibitor of protein phosphatase 1 (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
其它Ppp1r11产品