0610038F07Rik (BC060090) Mouse Recombinant Protein
CAT#: TP500796
Purified recombinant protein of Mouse RIKEN cDNA 0610038F07 gene (cDNA clone MGC:61338 IMAGE:5698361), complete cds, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>MR200796 protein sequence
Red=Cloning site Green=Tags(s) MAVVTLIPTLARALSKHSLLSPLPSVTSFRRFYRGDSPTDSQKDMIEIPLPPWQERTDESIETKRARLLY ESRKRGMLENCILLSLFAKEYLHNMTEKQLNLYDRLINEPSNDWDIYYWATGMPYAELHLGIIR myc-FLAG tag |
| Tag | C-MYC/DDK |
| Predicted MW | 15.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C after receiving vials. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| Locus ID | 66072 |
| UniProt ID | Q8C6I2 |
| Refseq Size | 3993 |
| Cytogenetics | 19 A |
| Refseq ORF | 402 |
| Synonyms | MGC61338 |
| Summary | Plays an essential role in the assembly of succinate dehydrogenase (SDH), an enzyme complex (also referred to as respiratory complex II) that is a component of both the tricarboxylic acid (TCA) cycle and the mitochondrial electron transport chain, and which couples the oxidation of succinate to fumarate with the reduction of ubiquinone (coenzyme Q) to ubiquinol. Required for flavinylation (covalent attachment of FAD) of the flavoprotein subunit SDHA of the SDH catalytic dimer.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
其它0610038F07Rik产品
