Tsc22d3 (NM_010286) Mouse Recombinant Protein
CAT#: TP500843
Purified recombinant protein of Mouse TSC22 domain family, member 3 (Tsc22d3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
Product images
                    
                CNY 600.00
Specifications
| Product Data | |
| Species | Mouse | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >MR200843 protein sequence 
Red=Cloning site Green=Tags(s) MNTEMYQTPMEVAVYQLHNFSISFFSSLLGGDVVSVKLDNSASGASVVALDNKIEQAMDLVKNHLMYAVR EEVEVLKEQIRELLEKNSQLERENTLLKTLASPEQLEKFQSRLSPEEPAPEAPETPETPEAPGGSAV myc-FLAG tag  | 
        
| Tag | C-MYC/DDK | 
| Predicted MW | 15.2 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C after receiving vials. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_034416 | 
| Locus ID | 14605 | 
| UniProt ID | Q9Z2S7 | 
| Refseq Size | 1974 | 
| Cytogenetics | X F1 | 
| Refseq ORF | 411 | 
| Synonyms | DIP; Dsip1; Gilz; Tilz3; TSC-22R | 
| Summary | Protects T-cells from IL2 deprivation-induced apoptosis through the inhibition of FOXO3A transcriptional activity that leads to the down-regulation of the pro-apoptotic factor BCL2L11. In macrophages, plays a role in the anti-inflammatory and immunosuppressive effects of glucocorticoids and IL10. In T-cells, inhibits anti-CD3-induced NFKB1 nuclear translocation. In vitro, suppresses AP1 and NFKB1 DNA-binding activities (By similarity). Isoform 1 and isoform 4 inhibit myogenic differentiation and mediate anti-myogenic effects of glucocorticoids by binding and regulating MYOD1 and HDAC1 transcriptional activity resulting in reduced expression of MYOG.[UniProtKB/Swiss-Prot Function] | 
Documents
| FAQs | 
| SDS | 
其它Tsc22d3产品
