Kcne1l (NM_021487) Mouse Recombinant Protein
CAT#: TP500930
Purified recombinant protein of Mouse potassium voltage-gated channel, Isk-related family, member 1-like, pseudogene (Kcne1l), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
Product images

CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR200930 protein sequence
Red=Cloning site Green=Tags(s) MNCSESQRLQTLLNRLLLELHHRGNASGLGIGTGPSMGMGVVPDPFVGREATSAKGNDAYLYILLIMIFY ACLAGGLILAYTRSRKLVEAKDEPPLACVAEQEWVPAAIASADPENGQGLLAEGGHQLAAGALPALAQGA ERV myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 15 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_067462 |
Locus ID | 66240 |
UniProt ID | Q9QZ26 |
Refseq Size | 1446 |
Cytogenetics | X F2 |
Refseq ORF | 429 |
Synonyms | 1500015C14Rik; Kcne5; Mink |
Summary | Potassium channel ancillary subunit that is essential for generation of some native K(+) currents by virtue of formation of heteromeric ion channel complex with voltage-gated potassium (Kv) channel pore-forming alpha subunits. Functions as an inhibitory beta-subunit of the repolarizing cardiac potassium ion channel KCNQ1.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |